PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC036012.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 78aa    MW: 8552.58 Da    PI: 8.7991
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC036012.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer90.91.2e-282276358
   ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                  ++rY eC++NhAas+Ggh vDGC Ef p  g eg+  a++Ca CgCHRnFHR+ ve
  EcC036012.20 22 RIRYAECQRNHAASTGGHQVDGCTEFRPR-GVEGSDLAFTCATCGCHRNFHRKVVE 76
                  78**************************8.9999*******************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-152076IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.0E-262375IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-222473IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152323.4472574IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MKKVVLGRGE ESSSASSSRM PRIRYAECQR NHAASTGGHQ VDGCTEFRPR GVEGSDLAFT  60
CATCGCHRNF HRKVVENP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488922.14e-23PREDICTED: mini zinc finger protein 1-like
RefseqXP_008230765.14e-23PREDICTED: mini zinc finger protein 2
RefseqXP_007215197.14e-23hypothetical protein PRUPE_ppa013998mg
RefseqXP_016559051.14e-23PREDICTED: mini zinc finger protein 2
SwissprotQ9CA512e-21MIF1_ARATH; Mini zinc finger protein 1
TrEMBLA0A059ADI15e-52A0A059ADI1_EUCGR; Uncharacterized protein
STRINGSolyc02g067330.1.12e-22(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.12e-22mini zinc finger 1